Problem in drawing figure

[mjsull]

Problem in drawing figure

[mjsull]

Hi Le Phuong,

Make sure you only use spaces and also each line must be indented by the right amount using only spaces. Have a look at the example files for a guide.

Best,

Mitch

[luongphekidz07]

Hello Romen,
Thank you very much for your nice repsonse, I followed your recommendations but I failed.
Anyways, thank you very much for your help

[luongphekidz07]

Hello,
I am Le Phuong, currently, I am having the trouble with Easyfig, I can not change the color for the specific genes in Easy. When you have time, could you tell me how I can do it manually?
Thank you very much,

[romen86]

Hello Le Phuong,
I figure out the issue while drawing colour code for the specific gene.
For Example:
CDS 548..1435
/gene="xoxo"
/locus_tag="LGMCDKNP_00002"
/inference="ab initio prediction:Prodigal:2.6"
/inference="similar to AA sequence:RefSeq:YP_005744820.1"
/codon_start=1
/transl_table=11
/product="recombinase"
/colour=16
/translation="METIIEEYLRFIQIEKGLSSNTIGAYRRDLKKYQDYM
IDFIDRQLIQECLGHNGYRDRTMLELLYATGMRVSELIHLELENVNL
IMGFVRVFGKGDKERIVPLGDAVIETVTEVLFLNMHGKPLSR THV
QAIWKMIKQNHSFATHLLENGADLRAVQEMLGHSDISTTQLYRH
SQIRKMYNQFHPRA"
After /product="site-specific recombinase XerD", Use Enter Key to begin new line and press SpaceBar to reach and write /colour=16.
Note: Please do not use any Tab from the keyboard. Always use Spacebar while adding colour to the next line.

[luongphekidz07]

Hello Mitch,

Thank you very much for your help,
I will try again,

Yours sincerely,
Le Phuong.

[J-Chunyu]

Hello,
I am a novice in bioinformatics, and recently I have encountered some problems in the annotation of phages. May I ask which database is suitable for the annotation of phages？

[romen86]

Hi,
This question is beyond the issues of this software. However, as far as my knowledge you can use PHASTER webtool or Patric webserver.

[claire-elek]

Hi, I'm also having the same problem as romen86.

Easyfig gets stuck drawing figure. The blast .out files are generated, but the program just stops working at "drawing figure." I have been looking for a solution and asking questions for months now. Initially Easyfig worked fine on my Windows machine. I didn't change anything at all, and one day it just no longer worked.

This issue was first reported in 2018, it's now 2022. Does anyone have or know of a fix for this problem?

[DAFO7368]

I'm having the sameproblem. Easyfig gets stuck drawing figure, Has anyone solved the problem ?