Comments (8)
Hi,
The target positions are defined as all CBs within 10Å from any ligand atom in your binding site. You therefore need to know your binding site.
If you look at the example here: https://colab.research.google.com/github/patrickbryant1/Umol/blob/master/Umol.ipynb
you can see the target positions in stick format.
Hope this helps!
from umol.
Well,
I'm extremely grateful for your instructions. Maybe my description is not good. But what I'm really stuck on is how to determine the "target_pos $POCKET_INDICES", or binding site ligand-protein what didn't research before, like your example:
TARGET_POSITIONS:
51,52,54,55,56,57,58,59,60,61,62,63,65,66,77,78,79,80,81,82,83,84,85,86,87,88,89,90,91,93,94,95,96,97,98,99,100,101,102,104,105,125,128,129
Do you use a database or some other tool to finding this information that can share with me?
Have a nice day,
Livia.
from umol.
Hi,
This information has to be provided by you. Maybe look in the PDB for similar proteins with known ligands and take the site from there.
I realise that this field may be new to you (?). In general, a target site is predetermined for drug development (how else do you know you want to drug that site?). If the inverse problem is true and you have a drug you know binds to something but not how I recommend getting a crystal structure.
Hope this helps!
from umol.
Oh I understand.
I am really a newbie in this field. I have recetnly join a course and I am trying to read publication to understand it. If you have a step-by-step guide or instruction to figure out target position in this example, please help me. I am now trying to apply your approach in a new protein-ligand.
Many thanks to you.
Livia.
from umol.
What is your protein?
from umol.
Hi,
My ligand SMILES: CC1=C(Cl)C=C(NC(=O)NCC2=CC=C3C(=O)N(CC3=C2)C2CCC(=O)NC2=O)C=C1
My protein in Uniprot: Q96SW2
Thank you very much.
Livia.
from umol.
Hi,
Since you only have one ligand, I am not sure it is meaningful to use Umol. It is better to go to the lab. If you can't/don't want to do that I suggest perhaps focusing on another research topic as predictions will only get you so far.
Still, I provide a guide here:
If you search your Uniprot ID and look at available structures you can see that this is available with a bound peptide: https://www.rcsb.org/3d-view/4M91/1
You can now download this structure and extract all CBs in the protein (chain A) that are within 10Å from the peptide (chain B). These are your target residues:
47,48,49,50,51,53,54,55,56,57,58,59,60,61,89,90,91,94,97,98,102,103,104,105,106,107
sequence: SKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVSRQANEEYQILANSWRYSSAFSNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRL
Plug this into Umol and you will obtain a prediction. Note that doing research with AI-tools without really knowing what you are looking for or why is not recommended.
from umol.
If you do this you get the following:
The average ligand plDDT is: 54.2
This is quite low and the complex is probably inaccurate.
Running single predictions is the intended use for Umol. I recommend doing a large-scale screen towards your binding site and then verifying whatever you find in the lab. The inverse process you are currently applying is not very logical since you will have to go to the lab regardless.
from umol.
Related Issues (20)
- When run the 'predict.sh', how to use GPU to accelerate it HOT 1
- ValueError: operands could not be broadcast together with shapes (19,19) (2861,2861) HOT 3
- Selection of the interaction sites and pLDTT score HOT 4
- colab notebook error in prediction step HOT 7
- Docker to run it HOT 9
- Can ligand be inputted via sdf files instead of LIGAND_SMILES format? HOT 6
- Error during conda env creation HOT 1
- How to output more predicted poses HOT 2
- Some question about giant Protein HOT 1
- Environment failed to resolve HOT 2
- 'Config' object has no attribute 'define_bool_state' HOT 6
- Can Umol take 1 protein and 2 small molecules at the same time? HOT 1
- ValueError: setting an array element with a sequence. The requested array has an inhomogeneous shape after 1 dimensions. The detected shape was (1313,) + inhomogeneous part. HOT 1
- Error 'bash predict.sh' HOT 1
- conda enviroment problem HOT 8
- Predict ligand positions for large protein by multiple GPUs HOT 1
- [question]: Around training the model. HOT 5
- FileNotFoundError
- Colab crashes due to error in Install dependencies step HOT 1
- RecursionError: maximum recursion depth exceeded HOT 1
Recommend Projects
-
React
A declarative, efficient, and flexible JavaScript library for building user interfaces.
-
Vue.js
🖖 Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.
-
Typescript
TypeScript is a superset of JavaScript that compiles to clean JavaScript output.
-
TensorFlow
An Open Source Machine Learning Framework for Everyone
-
Django
The Web framework for perfectionists with deadlines.
-
Laravel
A PHP framework for web artisans
-
D3
Bring data to life with SVG, Canvas and HTML. 📊📈🎉
-
Recommend Topics
-
javascript
JavaScript (JS) is a lightweight interpreted programming language with first-class functions.
-
web
Some thing interesting about web. New door for the world.
-
server
A server is a program made to process requests and deliver data to clients.
-
Machine learning
Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.
-
Visualization
Some thing interesting about visualization, use data art
-
Game
Some thing interesting about game, make everyone happy.
Recommend Org
-
Facebook
We are working to build community through open source technology. NB: members must have two-factor auth.
-
Microsoft
Open source projects and samples from Microsoft.
-
Google
Google ❤️ Open Source for everyone.
-
Alibaba
Alibaba Open Source for everyone
-
D3
Data-Driven Documents codes.
-
Tencent
China tencent open source team.
from umol.