Comments (9)
Hi Laura,
I get it, thanks for trying! I am going to install gget on a linux machine, it does seem M1 specific. (I tried that Terminal app thing already, I had already disabled the "open with rosetta" box.) Thanks again.
from gget.
Likewise, thanks again!
from gget.
Hi Alex,
I don't see an issue with the tensorflow packages you sent. Could you please send me the command you ran? Did you try running gget setup alphafold
first?
from gget.
Hi Laura,
I get the same error, on a MacBook Pro (14-inch, 2021) running OS 12.4. I have the same tensorflow packages installed as Alex, and I did run gget setup alphafold
first:
(base) jpmccutc@BIOD2009 ~ % gget alphafold MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
zsh: illegal hardware instruction gget alphafold
(base) jpmccutc@BIOD2009 ~ %
Thanks,
--John
from gget.
Hi Laura,
I did run gget setup alphafold first. The command I ran was:
gget alphafold MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
In the mean time I also tried installing tensorflow with the M1 mac specific instructions ( https://developer.apple.com/metal/tensorflow-plugin/) and reinstalling gget, but this yields another error:
ERROR: Could not find a version that satisfies the requirement tensorflow-cpu (from alphafold) (from versions: none)
ERROR: No matching distribution found for tensorflow-cpu
Wed Aug 10 12:21:46 2022 ERROR AlphaFold installation failed.
Thanks for your help!
-Alex
from gget.
Hi Alex and John,
I am having trouble recreating your error. The package tensorflow should not be required to run gget alphafold (only tensorflow-cpu==2.5.0 is required). Could you please try again in a new environment? This works for me (on MacBook):
conda create -n alphafold python=3.9
conda activate alphafold
pip install -U gget
conda install -c conda-forge openmm=7.5.1
gget setup alphafold
gget alphafold MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP
from gget.
Thanks, Laura. Unfortunately I still get the same error.
from gget.
Same here. I also tried downgrading tensorflow-cpu to 2.5.0 and got the same result.
from gget.
This is difficult for me to debug since I cannot reproduce the error (it seems M1 specific?).
These recommendations might be worth giving a try:
Some people recommend using Python version 3.8.5. (apple/tensorflow_macos#143)
From https://www.pythonfixing.com/2021/11/fixed-illegal-hardware-instruction.html:
Seemed like my terminal app was running in Rosetta. This can be changed by right-clicking on the app -> get info -> disable "open with rosetta".
from gget.
Related Issues (20)
- Error running alphafold HOT 5
- Frozen terminal HOT 1
- AlphaFold model parameters download error HOT 3
- Fails to depict and answer the polymeric forms HOT 4
- openmm=7.5.1 is no longer available from conda-forge. HOT 2
- pdb module HOT 2
- Keyerror: "0000:query" HOT 5
- AlphaFold Multimer HOT 4
- Error detecting openmm HOT 14
- Add Uniprot localisation data HOT 3
- Jupyter Notebook Kernel Dies When Using gget alphafold HOT 3
- gget alphafold: Add option to define jackhmmer save directory
- AttributeError: module 'psutil' has no attribute 'Process' HOT 5
- [gget_alphafold] - Feature Request - Add an option to submit a MSA instead of a protein sequence HOT 1
- Add lxml package to requirements.txt dependencies HOT 1
- gget alphafold: RuntimeError: jaxlib version 0.4.1 is newer than and incompatible with jax version 0.3.25. Please update your jax and/or jaxlib packages HOT 1
- gget info should return results that were fetched succesfully, even if one database returns an error HOT 2
- Error in gget setup alphafold: Ignored the following versions that require a different python version... HOT 6
- Ability to match parameters of BLAST as per the web app HOT 2
- Improve 'curl is missing' error for gget ref -d (include link to install instructions) HOT 3
Recommend Projects
-
React
A declarative, efficient, and flexible JavaScript library for building user interfaces.
-
Vue.js
🖖 Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.
-
Typescript
TypeScript is a superset of JavaScript that compiles to clean JavaScript output.
-
TensorFlow
An Open Source Machine Learning Framework for Everyone
-
Django
The Web framework for perfectionists with deadlines.
-
Laravel
A PHP framework for web artisans
-
D3
Bring data to life with SVG, Canvas and HTML. 📊📈🎉
-
Recommend Topics
-
javascript
JavaScript (JS) is a lightweight interpreted programming language with first-class functions.
-
web
Some thing interesting about web. New door for the world.
-
server
A server is a program made to process requests and deliver data to clients.
-
Machine learning
Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.
-
Visualization
Some thing interesting about visualization, use data art
-
Game
Some thing interesting about game, make everyone happy.
Recommend Org
-
Facebook
We are working to build community through open source technology. NB: members must have two-factor auth.
-
Microsoft
Open source projects and samples from Microsoft.
-
Google
Google ❤️ Open Source for everyone.
-
Alibaba
Alibaba Open Source for everyone
-
D3
Data-Driven Documents codes.
-
Tencent
China tencent open source team.
from gget.