Comments (4)
Hi! It might be worth playing around with the mono- versus multimer function in gget alphafold. If you pass each sequence of the hexamer separately as a list (or in a .fa), the program will automatically use the multimer model. This will take much longer but might yield results closer to the expected structure.
from gget.
from gget.
i also happen to face an issue with supplying a fasta file to read as it returns an error that fasta file starts with '>' but myt file does contain the '>' symbol at the starting.
And i am plotting the pdb file separately in pymol, is the plotting function embedded in gget alphafold as i couldnt get any plot
from gget.
Hi, I ran gget alphafold on a fasta file containing the chloride dismutase sequence (from PDB 2VXH) 6 times (pasted below) (terminal command: gget alphafold 2VXH.fa
). (Note: I had no problem inputting the fasta file. Please make sure your fasta is formatted correctly, starting with a single-line description without any characters/lines preceding the ">".) Inputting several sequences automatically uses the multimer model. The resulting prediction looks as follows:
>1
GSHMQPMQAMKIERGTILTQPGVFGVFTMFKLRPDWNKVPAMERKGAAEEVKKLIEKHKDNVLVDLYLTRGLETNSDFFFRINAYDLAKAQTFMREFRSTTIGKNADVFETLVGVTKPLNYISKDKSPGLNAGLSSATYSGPAPRYVIVIPVKKNAEWWNMSPEERLKEMEVHTTPTLAYLVNVKRKLYHSTGLDDTDFITYFETDDLTAFNNLMLSLAQVKENKFHVRWGSPTTLGTIHSPEDVIKALAD
>2
GSHMQPMQAMKIERGTILTQPGVFGVFTMFKLRPDWNKVPAMERKGAAEEVKKLIEKHKDNVLVDLYLTRGLETNSDFFFRINAYDLAKAQTFMREFRSTTIGKNADVFETLVGVTKPLNYISKDKSPGLNAGLSSATYSGPAPRYVIVIPVKKNAEWWNMSPEERLKEMEVHTTPTLAYLVNVKRKLYHSTGLDDTDFITYFETDDLTAFNNLMLSLAQVKENKFHVRWGSPTTLGTIHSPEDVIKALAD
>3
GSHMQPMQAMKIERGTILTQPGVFGVFTMFKLRPDWNKVPAMERKGAAEEVKKLIEKHKDNVLVDLYLTRGLETNSDFFFRINAYDLAKAQTFMREFRSTTIGKNADVFETLVGVTKPLNYISKDKSPGLNAGLSSATYSGPAPRYVIVIPVKKNAEWWNMSPEERLKEMEVHTTPTLAYLVNVKRKLYHSTGLDDTDFITYFETDDLTAFNNLMLSLAQVKENKFHVRWGSPTTLGTIHSPEDVIKALAD
>4
GSHMQPMQAMKIERGTILTQPGVFGVFTMFKLRPDWNKVPAMERKGAAEEVKKLIEKHKDNVLVDLYLTRGLETNSDFFFRINAYDLAKAQTFMREFRSTTIGKNADVFETLVGVTKPLNYISKDKSPGLNAGLSSATYSGPAPRYVIVIPVKKNAEWWNMSPEERLKEMEVHTTPTLAYLVNVKRKLYHSTGLDDTDFITYFETDDLTAFNNLMLSLAQVKENKFHVRWGSPTTLGTIHSPEDVIKALAD
>5
GSHMQPMQAMKIERGTILTQPGVFGVFTMFKLRPDWNKVPAMERKGAAEEVKKLIEKHKDNVLVDLYLTRGLETNSDFFFRINAYDLAKAQTFMREFRSTTIGKNADVFETLVGVTKPLNYISKDKSPGLNAGLSSATYSGPAPRYVIVIPVKKNAEWWNMSPEERLKEMEVHTTPTLAYLVNVKRKLYHSTGLDDTDFITYFETDDLTAFNNLMLSLAQVKENKFHVRWGSPTTLGTIHSPEDVIKALAD
>6
GSHMQPMQAMKIERGTILTQPGVFGVFTMFKLRPDWNKVPAMERKGAAEEVKKLIEKHKDNVLVDLYLTRGLETNSDFFFRINAYDLAKAQTFMREFRSTTIGKNADVFETLVGVTKPLNYISKDKSPGLNAGLSSATYSGPAPRYVIVIPVKKNAEWWNMSPEERLKEMEVHTTPTLAYLVNVKRKLYHSTGLDDTDFITYFETDDLTAFNNLMLSLAQVKENKFHVRWGSPTTLGTIHSPEDVIKALAD
The plotting functions are only called when using gget in a Python environment (e.g. Jupyter Lab/Google Colab). If using from terminal, I would indeed recommend to open the pdb result in PyMol or here.
from gget.
Related Issues (20)
- Rewrite gget BLAST to use BLAST+ instead of deprecated NCBI server
- Invalid command line Expected -option_name or --option_name, got '-' using gget muscle HOT 6
- Request addition of Open Targets API
- Multiple sequence alignment for multiple species HOT 10
- gget seq encounters missing gene name from uniprot and throws type error HOT 2
- gget.cellxgene TileDBError error when trying to return anndata HOT 4
- Add module to COSMIC database
- Add module for reactome
- KeyError: 'Primary_Acc' HOT 3
- Module to download MitoCarta3 database
- Is it possible to get all ELM's using gget? HOT 4
- Add module to depmap database HOT 1
- gget blast can not restrict by taxonomy
- GENCODE GTFs+FASTAs
- cellxgene filter improvements HOT 1
- gget blast sequence needs to be capitalized for automatic recognition of nucleotide/amino acid seq HOT 1
- Request addition of Eukaryotic Linear Motif database HOT 1
- Specify version in ensembl "search" module HOT 2
- expand gget search to include synonym hits in addition to name and description hits HOT 4
- gget pdb error in python HOT 3
Recommend Projects
-
React
A declarative, efficient, and flexible JavaScript library for building user interfaces.
-
Vue.js
🖖 Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.
-
Typescript
TypeScript is a superset of JavaScript that compiles to clean JavaScript output.
-
TensorFlow
An Open Source Machine Learning Framework for Everyone
-
Django
The Web framework for perfectionists with deadlines.
-
Laravel
A PHP framework for web artisans
-
D3
Bring data to life with SVG, Canvas and HTML. 📊📈🎉
-
Recommend Topics
-
javascript
JavaScript (JS) is a lightweight interpreted programming language with first-class functions.
-
web
Some thing interesting about web. New door for the world.
-
server
A server is a program made to process requests and deliver data to clients.
-
Machine learning
Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.
-
Visualization
Some thing interesting about visualization, use data art
-
Game
Some thing interesting about game, make everyone happy.
Recommend Org
-
Facebook
We are working to build community through open source technology. NB: members must have two-factor auth.
-
Microsoft
Open source projects and samples from Microsoft.
-
Google
Google ❤️ Open Source for everyone.
-
Alibaba
Alibaba Open Source for everyone
-
D3
Data-Driven Documents codes.
-
Tencent
China tencent open source team.
from gget.