Comments (4)
I have a similar problem on Ubuntu 18.04.3 and Debian 9.6 (x86_64) with pblat v. 36x2
pblat -t=dnax -q=prot -threads=2 -minIdentity=81 -minScore=15 genome.fa protein.fa out.psl
finished for -threads=2 (and more) with
Loaded 560 letters in 1 sequences
Blatx 1 sequences in database, 2 files in query
free(): double free detected in tcache 2
Aborted (core dumped)
and for -threads=1 with
Loaded 560 letters in 1 sequences
Blatx 1 sequences in database, 3 files in query
Segmentation fault (core dumped)
with genome.fa:
>test
TTCTGTTTCTATTTTGTGGTTACTTTGAGGAGAGTTGGAATTAGGTCTTCTTTGAAGGTCTGGTAGAACT
CTGCATTAAACCCATCTGGTCCTGGGCTTTTTTTTTTTTTTTTTTTTTTTTTTGGGTGGGAGACTATTGA
TGACTGCCTCTATTTCTTTAGGGGAAATGGGACTTTTAGTCCATGAATCTGATCCTGATTTAGCTTTGGT
ACCTGGTATCTGTCTAGGAAGTTGTCCATTTCATCCAGGTTTTCCTGGTTTTTTTTTAGTATAGCCTTTC
ATAGTAAAATCTGATGATGTTTTTGATATCCTCATGTTCTGTTGGTATGTCTCCTTTTTCATTTCTGATT
TTGTTAATTATAGTACAGTCCCTATGCCCTCTAGTTAGTCTGGCTAAGGGTTTATCTATCTTGTTGACTT
TCTCAAAGAACCAGCTACTATTTTGGTTGATTCTTTGAATATTTCTTTTTGTTTCCACTTGGTTGATTTC
AGCTCTGAGTTTGATTATTTCCTGCTGTCTACTCATCTTGGGTGAATTTGCTTCCTTTTGTTCTAGAGCT
and protein.fa:
>testA
MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTWPDKARRLGYKAKQGYVIYRIRVRRGG
RKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHK
AIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGLGKGHKFHHTIGGSRRAAWRRRNTLQLHRYR
>testB
MAHSERANGLQESNQRYGSLQEQLPKAGNQAVGPIEIFRFADNLDIVLMTLGILASMINGATVPLMSLVL
GEISDHFINGCLVQTNKTKYQNCSQSQEKLNEDIIMLTLYYVGIGAAALVLGYVQISFWVITAARQTTRI
RKQFFHSILAQDISWFDGTDICELNTRMNGDISKLCDGIGDKIPLMFQNISGFSIGLVISLIKSWKLSLA
ILSTSPLIMAASALCSRMVISLTSKELDAYSKAGAVAEEALSSIRTVTAFGAQEKEIQRYTQNLKDAKDA
The files are artificial just to reproduce the error, it happens with much larger genome and protein files too.
The underlying blat program handle this input correct.
Many thanks
PS:
while pblat on ubuntu displays just the messages above, pblat in a singularity container running Debian 9.6 is more verbose:
Loaded 560 letters in 1 sequences
Blatx 1 sequences in database, 2 files in query
*** Error in `pblat': double free or corruption (out): 0x00005605861ad320 ***
======= Backtrace: =========
/lib/x86_64-linux-gnu/libc.so.6(+0x70bfb)[0x7f4a999d1bfb]
/lib/x86_64-linux-gnu/libc.so.6(+0x76fc6)[0x7f4a999d7fc6]
/lib/x86_64-linux-gnu/libc.so.6(+0x7780e)[0x7f4a999d880e]
pblat(+0x79da)[0x5605846d29da]
pblat(+0x7e82)[0x5605846d2e82]
pblat(+0x85f2)[0x5605846d35f2]
/lib/x86_64-linux-gnu/libc.so.6(__libc_start_main+0xf1)[0x7f4a999812e1]
pblat(+0x674a)[0x5605846d174a]
======= Memory map: ========
5605846cb000-5605847b2000 r-xp 00000000 07:04 21518 /usr/local/share/pblat/pblat
5605849b2000-5605849b3000 r--p 000e7000 07:04 21518 /usr/local/share/pblat/pblat
5605849b3000-5605849b6000 rw-p 000e8000 07:04 21518 /usr/local/share/pblat/pblat
5605849b6000-5605849c9000 rw-p 00000000 00:00 0
56058618c000-56058cfcb000 rw-p 00000000 00:00 0 [heap]
7f4a84000000-7f4a84021000 rw-p 00000000 00:00 0
7f4a84021000-7f4a88000000 ---p 00000000 00:00 0
7f4a8c000000-7f4a8c021000 rw-p 00000000 00:00 0
7f4a8c021000-7f4a90000000 ---p 00000000 00:00 0
7f4a91978000-7f4a91979000 ---p 00000000 00:00 0
7f4a91979000-7f4a92179000 rw-p 00000000 00:00 0
7f4a92179000-7f4a9217a000 ---p 00000000 00:00 0
7f4a9217a000-7f4a9297a000 rw-p 00000000 00:00 0
7f4a99546000-7f4a9955c000 r-xp 00000000 07:04 1495 /lib/x86_64-linux-gnu/libgcc_s.so.1
7f4a9955c000-7f4a9975b000 ---p 00016000 07:04 1495 /lib/x86_64-linux-gnu/libgcc_s.so.1
7f4a9975b000-7f4a9975c000 r--p 00015000 07:04 1495 /lib/x86_64-linux-gnu/libgcc_s.so.1
7f4a9975c000-7f4a9975d000 rw-p 00016000 07:04 1495 /lib/x86_64-linux-gnu/libgcc_s.so.1
7f4a9975d000-7f4a99760000 r-xp 00000000 07:04 1485 /lib/x86_64-linux-gnu/libdl-2.24.so
7f4a99760000-7f4a9995f000 ---p 00003000 07:04 1485 /lib/x86_64-linux-gnu/libdl-2.24.so
7f4a9995f000-7f4a99960000 r--p 00002000 07:04 1485 /lib/x86_64-linux-gnu/libdl-2.24.so
7f4a99960000-7f4a99961000 rw-p 00003000 07:04 1485 /lib/x86_64-linux-gnu/libdl-2.24.so
7f4a99961000-7f4a99af6000 r-xp 00000000 07:04 1471 /lib/x86_64-linux-gnu/libc-2.24.so
7f4a99af6000-7f4a99cf6000 ---p 00195000 07:04 1471 /lib/x86_64-linux-gnu/libc-2.24.so
7f4a99cf6000-7f4a99cfa000 r--p 00195000 07:04 1471 /lib/x86_64-linux-gnu/libc-2.24.so
7f4a99cfa000-7f4a99cfc000 rw-p 00199000 07:04 1471 /lib/x86_64-linux-gnu/libc-2.24.so
7f4a99cfc000-7f4a99d00000 rw-p 00000000 00:00 0
7f4a99d00000-7f4a99f6a000 r-xp 00000000 07:04 16919 /usr/lib/x86_64-linux-gnu/libcrypto.so.1.1
7f4a99f6a000-7f4a9a16a000 ---p 0026a000 07:04 16919 /usr/lib/x86_64-linux-gnu/libcrypto.so.1.1
7f4a9a16a000-7f4a9a188000 r--p 0026a000 07:04 16919 /usr/lib/x86_64-linux-gnu/libcrypto.so.1.1
7f4a9a188000-7f4a9a196000 rw-p 00288000 07:04 16919 /usr/lib/x86_64-linux-gnu/libcrypto.so.1.1
7f4a9a196000-7f4a9a199000 rw-p 00000000 00:00 0
7f4a9a199000-7f4a9a1fc000 r-xp 00000000 07:04 17417 /usr/lib/x86_64-linux-gnu/libssl.so.1.1
7f4a9a1fc000-7f4a9a3fb000 ---p 00063000 07:04 17417 /usr/lib/x86_64-linux-gnu/libssl.so.1.1
7f4a9a3fb000-7f4a9a3ff000 r--p 00062000 07:04 17417 /usr/lib/x86_64-linux-gnu/libssl.so.1.1
7f4a9a3ff000-7f4a9a405000 rw-p 00066000 07:04 17417 /usr/lib/x86_64-linux-gnu/libssl.so.1.1
7f4a9a405000-7f4a9a41e000 r-xp 00000000 07:04 1587 /lib/x86_64-linux-gnu/libz.so.1.2.8
7f4a9a41e000-7f4a9a61d000 ---p 00019000 07:04 1587 /lib/x86_64-linux-gnu/libz.so.1.2.8
7f4a9a61d000-7f4a9a61e000 r--p 00018000 07:04 1587 /lib/x86_64-linux-gnu/libz.so.1.2.8
7f4a9a61e000-7f4a9a61f000 rw-p 00019000 07:04 1587 /lib/x86_64-linux-gnu/libz.so.1.2.8
7f4a9a61f000-7f4a9a637000 r-xp 00000000 07:04 1556 /lib/x86_64-linux-gnu/libpthread-2.24.so
7f4a9a637000-7f4a9a836000 ---p 00018000 07:04 1556 /lib/x86_64-linux-gnu/libpthread-2.24.so
7f4a9a836000-7f4a9a837000 r--p 00017000 07:04 1556 /lib/x86_64-linux-gnu/libpthread-2.24.so
7f4a9a837000-7f4a9a838000 rw-p 00018000 07:04 1556 /lib/x86_64-linux-gnu/libpthread-2.24.so
7f4a9a838000-7f4a9a83c000 rw-p 00000000 00:00 0
7f4a9a83c000-7f4a9a93f000 r-xp 00000000 07:04 1514 /lib/x86_64-linux-gnu/libm-2.24.so
7f4a9a93f000-7f4a9ab3e000 ---p 00103000 07:04 1514 /lib/x86_64-linux-gnu/libm-2.24.so
7f4a9ab3e000-7f4a9ab3f000 r--p 00102000 07:04 1514 /lib/x86_64-linux-gnu/libm-2.24.so
7f4a9ab3f000-7f4a9ab40000 rw-p 00103000 07:04 1514 /lib/x86_64-linux-gnu/libm-2.24.so
7f4a9ab40000-7f4a9ab63000 r-xp 00000000 07:04 1447 /lib/x86_64-linux-gnu/ld-2.24.so
7f4a9ad52000-7f4a9ad58000 rw-p 00000000 00:00 0
7f4a9ad62000-7f4a9ad63000 rw-p 00000000 00:00 0
7f4a9ad63000-7f4a9ad64000 r--p 00023000 07:04 1447 /lib/x86_64-linux-gnu/ld-2.24.so
7f4a9ad64000-7f4a9ad65000 rw-p 00024000 07:04 1447 /lib/x86_64-linux-gnu/ld-2.24.so
7f4a9ad65000-7f4a9ad66000 rw-p 00000000 00:00 0
7fff93761000-7fff93783000 rw-p 00000000 00:00 0 [stack]
7fff937f0000-7fff937f3000 r--p 00000000 00:00 0 [vvar]
7fff937f3000-7fff937f5000 r-xp 00000000 00:00 0 [vdso]
ffffffffff600000-ffffffffff601000 r-xp 00000000 00:00 0 [vsyscall]
Aborted (core dumped)
from pblat.
Hi alima90 and hmehlan, currently the pblat doesn't support querying protein sequences against genome sequences in multithreads mode. I'll try to implement this in the future. Currently it only supports querying nucleotide sequences against genome sequences in multithreads.
from pblat.
Hello,
I also encountered segmentation fault when trying to align reads to mouse genome:
pblat -threads=32 -t=dna -q=rna genome.fa reads.fa output.psl
the size of the genome is 12GB and the reads.fa size is 2.3GB. Do you know what could be the problem?
Thanks
from pblat.
I fixed this in the new release (v2.5). Please compile with the latest code or install with bioconda.
from pblat.
Related Issues (19)
- pblat produces empty output file HOT 1
- installation fatal error 'openssl/ssl.h' file not found HOT 5
- Internal error jkOwnLib/trans3.c 71 HOT 2
- [malloc] error with protein query and DNA database HOT 1
- Segmentation fault core dumped on large genome HOT 1
- should update htslib version
- Bad file descriptor HOT 1
- installation issue (make: *** [all] Error 1) HOT 3
- Reading query from list HOT 1
- multiple definition with GCC > 10
- push new tag HOT 1
- shared memory HOT 1
- Time usage is the same between normal blat and pblat HOT 6
- update to blat v36x2? HOT 1
- AddressSanitizer: heap-buffer-overflow (Out-of-Bound Write) at lib/fa.c:483 HOT 2
- installation issue HOT 2
- empty tmp files HOT 1
- compile error: undefined reference to `gzgetc_' HOT 1
Recommend Projects
-
React
A declarative, efficient, and flexible JavaScript library for building user interfaces.
-
Vue.js
🖖 Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.
-
Typescript
TypeScript is a superset of JavaScript that compiles to clean JavaScript output.
-
TensorFlow
An Open Source Machine Learning Framework for Everyone
-
Django
The Web framework for perfectionists with deadlines.
-
Laravel
A PHP framework for web artisans
-
D3
Bring data to life with SVG, Canvas and HTML. 📊📈🎉
-
Recommend Topics
-
javascript
JavaScript (JS) is a lightweight interpreted programming language with first-class functions.
-
web
Some thing interesting about web. New door for the world.
-
server
A server is a program made to process requests and deliver data to clients.
-
Machine learning
Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.
-
Visualization
Some thing interesting about visualization, use data art
-
Game
Some thing interesting about game, make everyone happy.
Recommend Org
-
Facebook
We are working to build community through open source technology. NB: members must have two-factor auth.
-
Microsoft
Open source projects and samples from Microsoft.
-
Google
Google ❤️ Open Source for everyone.
-
Alibaba
Alibaba Open Source for everyone
-
D3
Data-Driven Documents codes.
-
Tencent
China tencent open source team.
from pblat.